Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for smilingone 51. smilingone Lv 1 19 pts. 9,144
  2. Avatar for phi16 52. phi16 Lv 1 19 pts. 9,143
  3. Avatar for tony46 53. tony46 Lv 1 18 pts. 9,131
  4. Avatar for dssb 54. dssb Lv 1 17 pts. 9,116
  5. Avatar for MicElephant 55. MicElephant Lv 1 17 pts. 9,110
  6. Avatar for cbwest 56. cbwest Lv 1 16 pts. 9,109
  7. Avatar for jobo0502 57. jobo0502 Lv 1 15 pts. 9,090
  8. Avatar for deLaCeiba 58. deLaCeiba Lv 1 15 pts. 9,047
  9. Avatar for jamiexq 59. jamiexq Lv 1 14 pts. 9,023
  10. Avatar for ViJay7019 60. ViJay7019 Lv 1 13 pts. 8,999

Comments