Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for hansvandenhof 61. hansvandenhof Lv 1 13 pts. 8,991
  2. Avatar for manu8170 62. manu8170 Lv 1 12 pts. 8,982
  3. Avatar for Ikuso 63. Ikuso Lv 1 12 pts. 8,978
  4. Avatar for altejoh 64. altejoh Lv 1 11 pts. 8,974
  5. Avatar for Scopper 65. Scopper Lv 1 11 pts. 8,973
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 10 pts. 8,968
  7. Avatar for dbuske 67. dbuske Lv 1 10 pts. 8,959
  8. Avatar for lupussapien 68. lupussapien Lv 1 10 pts. 8,958
  9. Avatar for joremen 69. joremen Lv 1 9 pts. 8,956
  10. Avatar for Bushman 70. Bushman Lv 1 9 pts. 8,954

Comments