Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for paroos 81. paroos Lv 1 5 pts. 8,778
  2. Avatar for SKSbell 82. SKSbell Lv 1 5 pts. 8,774
  3. Avatar for smholst 83. smholst Lv 1 5 pts. 8,773
  4. Avatar for NinjaGreg 84. NinjaGreg Lv 1 5 pts. 8,755
  5. Avatar for fryguy 85. fryguy Lv 1 4 pts. 8,739
  6. Avatar for Mydogisa Toelicker 86. Mydogisa Toelicker Lv 1 4 pts. 8,733
  7. Avatar for Savas 87. Savas Lv 1 4 pts. 8,730
  8. Avatar for rsosborne 88. rsosborne Lv 1 4 pts. 8,728
  9. Avatar for tomespen 89. tomespen Lv 1 4 pts. 8,698
  10. Avatar for D3m0n1q_733rz 90. D3m0n1q_733rz Lv 1 3 pts. 8,686

Comments