Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 9,531
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,466
  3. Avatar for Go Science 3. Go Science 65 pts. 9,423
  4. Avatar for Gargleblasters 4. Gargleblasters 52 pts. 9,400
  5. Avatar for Contenders 5. Contenders 41 pts. 9,368
  6. Avatar for HMT heritage 6. HMT heritage 32 pts. 9,367
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,353
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,302
  9. Avatar for Russian team 9. Russian team 14 pts. 9,291
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 10 pts. 9,273

Comments