Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,531
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,466
  3. Avatar for Go Science 3. Go Science 65 pts. 9,423
  4. Avatar for Gargleblasters 4. Gargleblasters 52 pts. 9,400
  5. Avatar for Contenders 5. Contenders 41 pts. 9,368
  6. Avatar for HMT heritage 6. HMT heritage 32 pts. 9,367
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,353
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,302
  9. Avatar for Russian team 9. Russian team 14 pts. 9,291
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 10 pts. 9,273
  1. Avatar for alcor29 171. alcor29 Lv 1 1 pt. 3,880
  2. Avatar for hpaege 172. hpaege Lv 1 1 pt. 3,880
  3. Avatar for techmaz 173. techmaz Lv 1 1 pt. 3,880
  4. Avatar for sevakat 174. sevakat Lv 1 1 pt. 3,880
  5. Avatar for potatopotatopotato 175. potatopotatopotato Lv 1 1 pt. 3,880
  6. Avatar for Formula350 176. Formula350 Lv 1 1 pt. 3,880
  7. Avatar for vlad8919 177. vlad8919 Lv 1 1 pt. 3,880

Comments