Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 9,531
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,466
  3. Avatar for Go Science 3. Go Science 65 pts. 9,423
  4. Avatar for Gargleblasters 4. Gargleblasters 52 pts. 9,400
  5. Avatar for Contenders 5. Contenders 41 pts. 9,368
  6. Avatar for HMT heritage 6. HMT heritage 32 pts. 9,367
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,353
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,302
  9. Avatar for Russian team 9. Russian team 14 pts. 9,291
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 10 pts. 9,273

  1. Avatar for hansvandenhof 61. hansvandenhof Lv 1 13 pts. 8,991
  2. Avatar for manu8170 62. manu8170 Lv 1 12 pts. 8,982
  3. Avatar for Ikuso 63. Ikuso Lv 1 12 pts. 8,978
  4. Avatar for altejoh 64. altejoh Lv 1 11 pts. 8,974
  5. Avatar for Scopper 65. Scopper Lv 1 11 pts. 8,973
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 10 pts. 8,968
  7. Avatar for dbuske 67. dbuske Lv 1 10 pts. 8,959
  8. Avatar for lupussapien 68. lupussapien Lv 1 10 pts. 8,958
  9. Avatar for joremen 69. joremen Lv 1 9 pts. 8,956
  10. Avatar for Bushman 70. Bushman Lv 1 9 pts. 8,954

Comments