1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Summary

• Created: April 06, 2017
• Expires: April 13, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

• 1. Beta Folders 100 pts. 9,531
• 2. Anthropic Dreams 81 pts. 9,466
• 3. Go Science 65 pts. 9,423
• 4. Gargleblasters 52 pts. 9,400
• 5. Contenders 41 pts. 9,368
• 6. HMT heritage 32 pts. 9,367
• 7. Void Crushers 24 pts. 9,353
• 8. L'Alliance Francophone 18 pts. 9,302
• 9. Russian team 14 pts. 9,291
• 10. D001x Med Chem MOOC 10 pts. 9,273

Top soloists

• 21. Bletchley Park 55 pts. 9,303
• 22. dcrwheeler 53 pts. 9,302
• 23. nicobul 52 pts. 9,302
• 24. frood66 50 pts. 9,290
• 25. kabubi 49 pts. 9,282
• 26. D001x_ErlandStevens 47 pts. 9,273
• 27. christioanchauvin 45 pts. 9,271
• 28. pvc78 44 pts. 9,266
• 29. johnmitch 43 pts. 9,264
• 30. Aubade01 41 pts. 9,263