Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for D001x Med Chem MOOC 11. D001x Med Chem MOOC 3 pts. 11,436
  2. Avatar for Russian team 12. Russian team 2 pts. 11,388
  3. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,960
  4. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 10,805
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 10,420
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,896
  7. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 7,906
  8. Avatar for Mojo Risin' 19. Mojo Risin' 1 pt. 7,832
  9. Avatar for BioChem22017 20. BioChem22017 1 pt. 211

  1. Avatar for bcre8tvv 111. bcre8tvv Lv 1 1 pt. 9,378
  2. Avatar for Alistair69 112. Alistair69 Lv 1 1 pt. 9,348
  3. Avatar for Jim Fraser 113. Jim Fraser Lv 1 1 pt. 9,231
  4. Avatar for senor pit 114. senor pit Lv 1 1 pt. 9,186
  5. Avatar for Nicolien 115. Nicolien Lv 1 1 pt. 9,149
  6. Avatar for Cerzax 116. Cerzax Lv 1 1 pt. 9,121
  7. Avatar for tweak64 117. tweak64 Lv 1 1 pt. 9,100
  8. Avatar for SouperGenious 118. SouperGenious Lv 1 1 pt. 9,081
  9. Avatar for momadoc 119. momadoc Lv 1 1 pt. 9,058
  10. Avatar for JamesChapman 120. JamesChapman Lv 1 1 pt. 8,797

Comments