Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 2 pts. 12,827
  2. Avatar for tomespen 22. tomespen Lv 1 1 pt. 12,580
  3. Avatar for SaraL 23. SaraL Lv 1 1 pt. 12,520
  4. Avatar for mimi 24. mimi Lv 1 1 pt. 12,206
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 1 pt. 12,191
  6. Avatar for gitwut 26. gitwut Lv 1 1 pt. 12,185
  7. Avatar for Scopper 27. Scopper Lv 1 1 pt. 12,048
  8. Avatar for georg137 28. georg137 Lv 1 1 pt. 12,022
  9. Avatar for Deleted player 29. Deleted player pts. 11,922
  10. Avatar for tokens 30. tokens Lv 1 1 pt. 11,883

Comments