Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521

  1. Avatar for mitarcher 121. mitarcher Lv 1 1 pt. 8,495
  2. Avatar for techmaz 122. techmaz Lv 1 1 pt. 8,495
  3. Avatar for NotJim99 123. NotJim99 Lv 1 1 pt. 8,296
  4. Avatar for sammiibee16 124. sammiibee16 Lv 1 1 pt. 8,284
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 8,242
  6. Avatar for SaraL 126. SaraL Lv 1 1 pt. 8,225
  7. Avatar for ChillyPepper 127. ChillyPepper Lv 1 1 pt. 8,187
  8. Avatar for jbmkfm125 128. jbmkfm125 Lv 1 1 pt. 7,914
  9. Avatar for Savas 129. Savas Lv 1 1 pt. 7,906
  10. Avatar for dbuske 130. dbuske Lv 1 1 pt. 7,868

Comments