Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521

  1. Avatar for Mike Cassidy 41. Mike Cassidy Lv 1 26 pts. 11,866
  2. Avatar for diamonddays 42. diamonddays Lv 1 25 pts. 11,834
  3. Avatar for Blipperman 43. Blipperman Lv 1 24 pts. 11,820
  4. Avatar for dcrwheeler 44. dcrwheeler Lv 1 23 pts. 11,754
  5. Avatar for joremen 45. joremen Lv 1 22 pts. 11,741
  6. Avatar for MicElephant 46. MicElephant Lv 1 21 pts. 11,690
  7. Avatar for georg137 47. georg137 Lv 1 20 pts. 11,642
  8. Avatar for crpainter 48. crpainter Lv 1 19 pts. 11,620
  9. Avatar for O Seki To 49. O Seki To Lv 1 19 pts. 11,603
  10. Avatar for Deleted player 50. Deleted player pts. 11,594

Comments