Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521
  1. Avatar for abysmal101 151. abysmal101 Lv 1 1 pt. 3,973
  2. Avatar for science-mathguy 152. science-mathguy Lv 1 1 pt. 3,857
  3. Avatar for arian77 153. arian77 Lv 1 1 pt. 3,384
  4. Avatar for Sachain 154. Sachain Lv 1 1 pt. 2,647
  5. Avatar for khendarg 155. khendarg Lv 1 1 pt. 1,381
  6. Avatar for rezaefar 156. rezaefar Lv 1 1 pt. 1,046
  7. Avatar for avaldivi 157. avaldivi Lv 1 1 pt. 211
  8. Avatar for Paulo Roque 158. Paulo Roque Lv 1 1 pt. 0
  9. Avatar for n.palominos 159. n.palominos Lv 1 1 pt. 0
  10. Avatar for phi16 160. phi16 Lv 1 1 pt. 0

Comments