Placeholder image of a protein
Icon representing a puzzle

1363: Unsolved De-novo Freestyle: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
April 07, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1360, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1360 and use them as a starting point here.



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,287
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 13,910
  3. Avatar for Go Science 3. Go Science 58 pts. 13,351
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 13,243
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 13,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 12,757
  7. Avatar for Deleted group 7. Deleted group pts. 12,640
  8. Avatar for Contenders 8. Contenders 11 pts. 12,206
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 11,603
  10. Avatar for xkcd 10. xkcd 5 pts. 11,521

  1. Avatar for reefyrob 11. reefyrob Lv 1 74 pts. 13,142
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 71 pts. 13,026
  3. Avatar for LociOiling 13. LociOiling Lv 1 69 pts. 12,973
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 67 pts. 12,926
  5. Avatar for Vredeman 15. Vredeman Lv 1 65 pts. 12,826
  6. Avatar for Keresto 16. Keresto Lv 1 63 pts. 12,778
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 61 pts. 12,757
  8. Avatar for jermainiac 18. jermainiac Lv 1 59 pts. 12,668
  9. Avatar for pauldunn 19. pauldunn Lv 1 57 pts. 12,661
  10. Avatar for ZeroLeak7 20. ZeroLeak7 Lv 1 55 pts. 12,644

Comments