Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  6. Avatar for SHELL 17. SHELL 1 pt. 5,410
  7. Avatar for Window Group 18. Window Group 1 pt. 3,369

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,489
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,470
  3. Avatar for markm457 3. markm457 Lv 1 95 pts. 9,451
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 9,426
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 90 pts. 9,425
  6. Avatar for Galaxie 6. Galaxie Lv 1 87 pts. 9,424
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 85 pts. 9,415
  8. Avatar for nicobul 8. nicobul Lv 1 83 pts. 9,414
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 80 pts. 9,413
  10. Avatar for smilingone 10. smilingone Lv 1 78 pts. 9,401

Comments