Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  6. Avatar for SHELL 17. SHELL 1 pt. 5,410
  7. Avatar for Window Group 18. Window Group 1 pt. 3,369

  1. Avatar for navn 111. navn Lv 1 1 pt. 8,903
  2. Avatar for joaniegirl 112. joaniegirl Lv 1 1 pt. 8,900
  3. Avatar for tarimo 113. tarimo Lv 1 1 pt. 8,899
  4. Avatar for gurch 114. gurch Lv 1 1 pt. 8,896
  5. Avatar for Mr_Jolty 115. Mr_Jolty Lv 1 1 pt. 8,888
  6. Avatar for trentis1 116. trentis1 Lv 1 1 pt. 8,876
  7. Avatar for pandapharmd 117. pandapharmd Lv 1 1 pt. 8,862
  8. Avatar for boondog 118. boondog Lv 1 1 pt. 8,858
  9. Avatar for Iron pet 119. Iron pet Lv 1 1 pt. 8,858
  10. Avatar for KiTCCCCC 120. KiTCCCCC Lv 1 1 pt. 8,837

Comments