Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  6. Avatar for SHELL 17. SHELL 1 pt. 5,410
  7. Avatar for Window Group 18. Window Group 1 pt. 3,369

  1. Avatar for khendarg 151. khendarg Lv 1 1 pt. 8,593
  2. Avatar for Inkedhands 152. Inkedhands Lv 1 1 pt. 8,582
  3. Avatar for Ungoliant 153. Ungoliant Lv 1 1 pt. 8,580
  4. Avatar for Formula350 154. Formula350 Lv 1 1 pt. 8,577
  5. Avatar for roman madala 155. roman madala Lv 1 1 pt. 8,556
  6. Avatar for Kiwegapa 156. Kiwegapa Lv 1 1 pt. 8,545
  7. Avatar for Jaco van As 157. Jaco van As Lv 1 1 pt. 8,541
  8. Avatar for cnhrcolemam 158. cnhrcolemam Lv 1 1 pt. 8,536
  9. Avatar for parsnip 159. parsnip Lv 1 1 pt. 8,507
  10. Avatar for Cerzax 160. Cerzax Lv 1 1 pt. 8,502

Comments