Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,173
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for xkcd 13. xkcd 1 pt. 8,992
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,888
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,500
  6. Avatar for SHELL 17. SHELL 1 pt. 5,410
  7. Avatar for Window Group 18. Window Group 1 pt. 3,369

  1. Avatar for mimi 21. mimi Lv 1 56 pts. 9,348
  2. Avatar for randomlil 22. randomlil Lv 1 54 pts. 9,345
  3. Avatar for Norrjane 23. Norrjane Lv 1 53 pts. 9,344
  4. Avatar for crpainter 24. crpainter Lv 1 51 pts. 9,342
  5. Avatar for reefyrob 25. reefyrob Lv 1 49 pts. 9,336
  6. Avatar for bertro 26. bertro Lv 1 48 pts. 9,329
  7. Avatar for jobo0502 27. jobo0502 Lv 1 46 pts. 9,328
  8. Avatar for katling 28. katling Lv 1 45 pts. 9,325
  9. Avatar for weitzen 29. weitzen Lv 1 43 pts. 9,324
  10. Avatar for harvardman 30. harvardman Lv 1 42 pts. 9,323

Comments