Placeholder image of a protein
Icon representing a puzzle

1365: Revisiting Puzzle 95: Chicken

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 13, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,489
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,476
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,458
  4. Avatar for Go Science 4. Go Science 38 pts. 9,425
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,415
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,414
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,408
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 8 pts. 9,314
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,306
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,244
  1. Avatar for Pibeagles 171. Pibeagles Lv 1 1 pt. 7,767
  2. Avatar for Soggy Doglog 172. Soggy Doglog Lv 1 1 pt. 7,321
  3. Avatar for 41622221LUOZHI 173. 41622221LUOZHI Lv 1 1 pt. 5,410
  4. Avatar for alcor29 174. alcor29 Lv 1 1 pt. 3,369
  5. Avatar for Paulo Roque 175. Paulo Roque Lv 1 1 pt. 3,369
  6. Avatar for jflat06 176. jflat06 Lv 1 1 pt. 3,369
  7. Avatar for guygeva2311 177. guygeva2311 Lv 1 1 pt. 3,369
  8. Avatar for annawrig 178. annawrig Lv 1 1 pt. 3,369
  9. Avatar for Hollinas 179. Hollinas Lv 1 1 pt. 3,369
  10. Avatar for yhbui 180. yhbui Lv 1 1 pt. 3,369

Comments