Placeholder image of a protein
Icon representing a puzzle

1369: Dysferlin Linker Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 21, 2017
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,143
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,104
  3. Avatar for xkcd 13. xkcd 1 pt. 8,104
  4. Avatar for Russian team 14. Russian team 1 pt. 7,918
  5. Avatar for Team South Africa 17. Team South Africa 1 pt. 5,951
  6. Avatar for BioChem22017 18. BioChem22017 1 pt. 4,268
  7. Avatar for Cannabis Crew 20. Cannabis Crew 1 pt. 0

  1. Avatar for Iron pet 111. Iron pet Lv 1 1 pt. 7,489
  2. Avatar for Alistair69 112. Alistair69 Lv 1 1 pt. 7,479
  3. Avatar for Fog Darts 113. Fog Darts Lv 1 1 pt. 7,456
  4. Avatar for NotJim99 114. NotJim99 Lv 1 1 pt. 7,335
  5. Avatar for mitarcher 115. mitarcher Lv 1 1 pt. 7,325
  6. Avatar for parsnip 116. parsnip Lv 1 1 pt. 7,268
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 7,268
  8. Avatar for Jkaano 118. Jkaano Lv 1 1 pt. 7,223
  9. Avatar for senor pit 119. senor pit Lv 1 1 pt. 7,194
  10. Avatar for bigcode 120. bigcode Lv 1 1 pt. 7,187

Comments