Foldit

1369: Dysferlin Linker Domain

Closed since almost 9 years ago

Summary

Created: April 21, 2017
Expires: April 28, 2017 at 23:00 UTC
Max points: 100

Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.

The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:

PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE