Placeholder image of a protein
Icon representing a puzzle

1369: Dysferlin Linker Domain

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 21, 2017
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,167
  2. Avatar for Go Science 2. Go Science 77 pts. 9,079
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,016
  4. Avatar for Contenders 4. Contenders 43 pts. 9,007
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,947
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 8,917
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 8,861
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,757
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 7 pts. 8,280
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,150

  1. Avatar for carsonfb 101. carsonfb Lv 1 2 pts. 7,688
  2. Avatar for Deleted player 102. Deleted player pts. 7,646
  3. Avatar for YGK 103. YGK Lv 1 2 pts. 7,592
  4. Avatar for smholst 104. smholst Lv 1 1 pt. 7,576
  5. Avatar for lupussapien 105. lupussapien Lv 1 1 pt. 7,567
  6. Avatar for lamoille 106. lamoille Lv 1 1 pt. 7,559
  7. Avatar for jamiexq 107. jamiexq Lv 1 1 pt. 7,521
  8. Avatar for trentis1 108. trentis1 Lv 1 1 pt. 7,503
  9. Avatar for sammiibee16 109. sammiibee16 Lv 1 1 pt. 7,500
  10. Avatar for Arne Heessels 110. Arne Heessels Lv 1 1 pt. 7,493

Comments