Placeholder image of a protein
Icon representing a puzzle

1369: Dysferlin Linker Domain

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 21, 2017
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,167
  2. Avatar for Go Science 2. Go Science 77 pts. 9,079
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,016
  4. Avatar for Contenders 4. Contenders 43 pts. 9,007
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,947
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 8,917
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 8,861
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,757
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 7 pts. 8,280
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,150

  1. Avatar for Pibeagles 121. Pibeagles Lv 1 1 pt. 7,169
  2. Avatar for Cerzax 122. Cerzax Lv 1 1 pt. 7,152
  3. Avatar for SouperGenious 123. SouperGenious Lv 1 1 pt. 7,093
  4. Avatar for xwjqv 124. xwjqv Lv 1 1 pt. 6,983
  5. Avatar for emdee314 125. emdee314 Lv 1 1 pt. 6,893
  6. Avatar for Inkedhands 126. Inkedhands Lv 1 1 pt. 6,841
  7. Avatar for NATETHEGUARD 127. NATETHEGUARD Lv 1 1 pt. 6,812
  8. Avatar for Museka 128. Museka Lv 1 1 pt. 6,687
  9. Avatar for feraltp 129. feraltp Lv 1 1 pt. 6,612
  10. Avatar for momadoc 130. momadoc Lv 1 1 pt. 6,597

Comments