Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,743
  3. Avatar for xkcd 13. xkcd 1 pt. 8,671
  4. Avatar for Window Group 14. Window Group 1 pt. 8,188
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 8,145
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663
  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,999
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 9,994
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 9,978
  4. Avatar for randomlil 4. randomlil Lv 1 91 pts. 9,966
  5. Avatar for pauldunn 5. pauldunn Lv 1 88 pts. 9,940
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 85 pts. 9,935
  7. Avatar for frood66 7. frood66 Lv 1 82 pts. 9,925
  8. Avatar for markm457 8. markm457 Lv 1 80 pts. 9,924
  9. Avatar for eusair 9. eusair Lv 1 77 pts. 9,919
  10. Avatar for tokens 10. tokens Lv 1 74 pts. 9,908

Comments