Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503
  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 10 pts. 9,935
  2. Avatar for smholst 12. smholst Lv 1 8 pts. 9,934
  3. Avatar for Hollinas 13. Hollinas Lv 1 6 pts. 9,930
  4. Avatar for Galaxie 14. Galaxie Lv 1 4 pts. 9,926
  5. Avatar for lamoille 15. lamoille Lv 1 3 pts. 9,925
  6. Avatar for tomespen 16. tomespen Lv 1 2 pts. 9,917
  7. Avatar for gitwut 17. gitwut Lv 1 2 pts. 9,916
  8. Avatar for Norrjane 18. Norrjane Lv 1 1 pt. 9,909
  9. Avatar for Deleted player 19. Deleted player pts. 9,904
  10. Avatar for Deleted player 20. Deleted player pts. 9,755

Comments