Placeholder image of a protein
Icon representing a puzzle

1372: Dysferlin Linker Domain: Predicted Contacts

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
April 28, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1369, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1369 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,546
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,446
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 8,550
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,092
  5. Avatar for freefolder 17. freefolder 1 pt. 6,476
  6. Avatar for BioChem22017 18. BioChem22017 1 pt. 4,713

  1. Avatar for Grom 51. Grom Lv 1 17 pts. 9,553
  2. Avatar for fryguy 52. fryguy Lv 1 16 pts. 9,546
  3. Avatar for fishercat 53. fishercat Lv 1 16 pts. 9,542
  4. Avatar for Vinara 54. Vinara Lv 1 15 pts. 9,500
  5. Avatar for guineapig 55. guineapig Lv 1 14 pts. 9,493
  6. Avatar for pfirth 56. pfirth Lv 1 14 pts. 9,456
  7. Avatar for Bushman 57. Bushman Lv 1 13 pts. 9,446
  8. Avatar for harvardman 58. harvardman Lv 1 13 pts. 9,437
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 12 pts. 9,436
  10. Avatar for anthion 60. anthion Lv 1 11 pts. 9,435

Comments