Placeholder image of a protein
Icon representing a puzzle

1372: Dysferlin Linker Domain: Predicted Contacts

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
April 28, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1369, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1369 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,546
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,446
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 8,550
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,092
  5. Avatar for freefolder 17. freefolder 1 pt. 6,476
  6. Avatar for BioChem22017 18. BioChem22017 1 pt. 4,713

  1. Avatar for phi16 61. phi16 Lv 1 11 pts. 9,419
  2. Avatar for martin.szew 62. martin.szew Lv 1 10 pts. 9,394
  3. Avatar for alcor29 63. alcor29 Lv 1 10 pts. 9,374
  4. Avatar for Flagg65a 64. Flagg65a Lv 1 10 pts. 9,364
  5. Avatar for crpainter 65. crpainter Lv 1 9 pts. 9,350
  6. Avatar for tony46 67. tony46 Lv 1 8 pts. 9,315
  7. Avatar for Jim Fraser 68. Jim Fraser Lv 1 8 pts. 9,309
  8. Avatar for jobo0502 69. jobo0502 Lv 1 8 pts. 9,293
  9. Avatar for SKSbell 70. SKSbell Lv 1 7 pts. 9,292

Comments