Placeholder image of a protein
Icon representing a puzzle

1372: Dysferlin Linker Domain: Predicted Contacts

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
April 28, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1369, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1369 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,876
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,731
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,586
  4. Avatar for Contenders 4. Contenders 43 pts. 10,453
  5. Avatar for Go Science 5. Go Science 31 pts. 10,314
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,295
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,116
  8. Avatar for Deleted group 8. Deleted group pts. 10,079
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,990
  10. Avatar for Russian team 10. Russian team 5 pts. 9,564

  1. Avatar for Deleted player 31. Deleted player pts. 10,001
  2. Avatar for O Seki To 32. O Seki To Lv 1 36 pts. 9,990
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 35 pts. 9,970
  4. Avatar for frood66 34. frood66 Lv 1 33 pts. 9,898
  5. Avatar for weitzen 35. weitzen Lv 1 32 pts. 9,870
  6. Avatar for NinjaGreg 36. NinjaGreg Lv 1 31 pts. 9,847
  7. Avatar for Scopper 37. Scopper Lv 1 30 pts. 9,845
  8. Avatar for Vredeman 38. Vredeman Lv 1 29 pts. 9,812
  9. Avatar for katling 39. katling Lv 1 28 pts. 9,787
  10. Avatar for randomlil 40. randomlil Lv 1 26 pts. 9,756

Comments