Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,442
  3. Avatar for xkcd 13. xkcd 1 pt. 8,436
  4. Avatar for freefolder 14. freefolder 1 pt. 8,370
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820
  1. Avatar for georg137
    1. georg137 Lv 1
    100 pts. 8,624
  2. Avatar for gitwut 2. gitwut Lv 1 83 pts. 8,624
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 68 pts. 8,620
  4. Avatar for LociOiling 4. LociOiling Lv 1 55 pts. 8,617
  5. Avatar for reefyrob 5. reefyrob Lv 1 44 pts. 8,616
  6. Avatar for smilingone 6. smilingone Lv 1 35 pts. 8,614
  7. Avatar for Galaxie 7. Galaxie Lv 1 27 pts. 8,610
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 21 pts. 8,610
  9. Avatar for toshiue 9. toshiue Lv 1 16 pts. 8,610
  10. Avatar for pauldunn 10. pauldunn Lv 1 12 pts. 8,610

Comments