Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for xkcd 13. xkcd 1 pt. 8,436
  3. Avatar for freefolder 14. freefolder 1 pt. 8,370
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  6. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 8,626
  2. Avatar for tokens 2. tokens Lv 1 98 pts. 8,618
  3. Avatar for smilingone 3. smilingone Lv 1 95 pts. 8,616
  4. Avatar for markm457 4. markm457 Lv 1 93 pts. 8,612
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 90 pts. 8,609
  6. Avatar for nicobul 6. nicobul Lv 1 88 pts. 8,607
  7. Avatar for eusair 7. eusair Lv 1 85 pts. 8,607
  8. Avatar for bertro 8. bertro Lv 1 83 pts. 8,594
  9. Avatar for LociOiling 9. LociOiling Lv 1 81 pts. 8,593
  10. Avatar for actiasluna 10. actiasluna Lv 1 78 pts. 8,591

Comments