Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for xkcd 13. xkcd 1 pt. 8,436
  3. Avatar for freefolder 14. freefolder 1 pt. 8,370
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  6. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820

  1. Avatar for BandorKitty 101. BandorKitty Lv 1 3 pts. 8,339
  2. Avatar for cobaltteal 102. cobaltteal Lv 1 2 pts. 8,336
  3. Avatar for harvardman 103. harvardman Lv 1 2 pts. 8,336
  4. Avatar for froggs554 104. froggs554 Lv 1 2 pts. 8,331
  5. Avatar for ralan-nsk 105. ralan-nsk Lv 1 2 pts. 8,331
  6. Avatar for rabamino12358 106. rabamino12358 Lv 1 2 pts. 8,329
  7. Avatar for Superphosphate 107. Superphosphate Lv 1 2 pts. 8,328
  8. Avatar for cbwest 108. cbwest Lv 1 2 pts. 8,328
  9. Avatar for ViJay7019 109. ViJay7019 Lv 1 2 pts. 8,325
  10. Avatar for Pyotr 110. Pyotr Lv 1 2 pts. 8,312

Comments