Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,442
  3. Avatar for xkcd 13. xkcd 1 pt. 8,436
  4. Avatar for freefolder 14. freefolder 1 pt. 8,370
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820
  1. Avatar for techbites457 151. techbites457 Lv 1 1 pt. 8,061
  2. Avatar for alcor29 152. alcor29 Lv 1 1 pt. 8,050
  3. Avatar for MsHsi 153. MsHsi Lv 1 1 pt. 8,034
  4. Avatar for martinf 154. martinf Lv 1 1 pt. 8,022
  5. Avatar for sammiibee16 155. sammiibee16 Lv 1 1 pt. 8,015
  6. Avatar for Mike Cassidy 156. Mike Cassidy Lv 1 1 pt. 8,014
  7. Avatar for Ciccillo 157. Ciccillo Lv 1 1 pt. 7,969
  8. Avatar for DNALVR 158. DNALVR Lv 1 1 pt. 7,969
  9. Avatar for Ref_Jo 159. Ref_Jo Lv 1 1 pt. 7,962
  10. Avatar for awilson0 160. awilson0 Lv 1 1 pt. 7,926

Comments