Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,442
  3. Avatar for xkcd 13. xkcd 1 pt. 8,436
  4. Avatar for freefolder 14. freefolder 1 pt. 8,370
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820
  1. Avatar for caglar 11. caglar Lv 1 76 pts. 8,589
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 74 pts. 8,583
  3. Avatar for O Seki To 13. O Seki To Lv 1 72 pts. 8,582
  4. Avatar for randomlil 14. randomlil Lv 1 70 pts. 8,581
  5. Avatar for frood66 15. frood66 Lv 1 68 pts. 8,581
  6. Avatar for Aubade01 16. Aubade01 Lv 1 66 pts. 8,580
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 64 pts. 8,579
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 62 pts. 8,574
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 60 pts. 8,574
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 59 pts. 8,571

Comments