1374: Revisiting Puzzle 109: Pumpkin
Closed since almost 9 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- May 04, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.
Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK