Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for xkcd 13. xkcd 1 pt. 8,436
  3. Avatar for freefolder 14. freefolder 1 pt. 8,370
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  6. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820

  1. Avatar for deLaCeiba 71. deLaCeiba Lv 1 10 pts. 8,439
  2. Avatar for fryguy 72. fryguy Lv 1 9 pts. 8,436
  3. Avatar for tarimo 73. tarimo Lv 1 9 pts. 8,432
  4. Avatar for leehaggis 74. leehaggis Lv 1 9 pts. 8,432
  5. Avatar for mimi 75. mimi Lv 1 8 pts. 8,431
  6. Avatar for jermainiac 76. jermainiac Lv 1 8 pts. 8,428
  7. Avatar for Arne Heessels 77. Arne Heessels Lv 1 8 pts. 8,426
  8. Avatar for Glen B 78. Glen B Lv 1 7 pts. 8,426
  9. Avatar for firejuggler 79. firejuggler Lv 1 7 pts. 8,422
  10. Avatar for tony46 80. tony46 Lv 1 7 pts. 8,410

Comments