Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for techbites457 151. techbites457 Lv 1 1 pt. 8,061
  2. Avatar for alcor29 152. alcor29 Lv 1 1 pt. 8,050
  3. Avatar for MsHsi 153. MsHsi Lv 1 1 pt. 8,034
  4. Avatar for martinf 154. martinf Lv 1 1 pt. 8,022
  5. Avatar for sammiibee16 155. sammiibee16 Lv 1 1 pt. 8,015
  6. Avatar for Mike Cassidy 156. Mike Cassidy Lv 1 1 pt. 8,014
  7. Avatar for Ciccillo 157. Ciccillo Lv 1 1 pt. 7,969
  8. Avatar for DNALVR 158. DNALVR Lv 1 1 pt. 7,969
  9. Avatar for Ref_Jo 159. Ref_Jo Lv 1 1 pt. 7,962
  10. Avatar for awilson0 160. awilson0 Lv 1 1 pt. 7,926

Comments