Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for YeshuaLives 31. YeshuaLives Lv 1 42 pts. 8,548
  2. Avatar for dssb 32. dssb Lv 1 40 pts. 8,547
  3. Avatar for Deleted player 33. Deleted player pts. 8,545
  4. Avatar for pauldunn 34. pauldunn Lv 1 38 pts. 8,540
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 37 pts. 8,537
  6. Avatar for kabubi 36. kabubi Lv 1 36 pts. 8,529
  7. Avatar for jobo0502 37. jobo0502 Lv 1 34 pts. 8,526
  8. Avatar for Bushman 38. Bushman Lv 1 33 pts. 8,525
  9. Avatar for Norrjane 39. Norrjane Lv 1 32 pts. 8,525
  10. Avatar for crpainter 40. crpainter Lv 1 31 pts. 8,521

Comments