Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 15 pts. 8,459
  2. Avatar for weitzen 62. weitzen Lv 1 14 pts. 8,459
  3. Avatar for MicElephant 63. MicElephant Lv 1 13 pts. 8,459
  4. Avatar for joremen 64. joremen Lv 1 13 pts. 8,450
  5. Avatar for carsonfb 65. carsonfb Lv 1 12 pts. 8,447
  6. Avatar for TastyMunchies 66. TastyMunchies Lv 1 12 pts. 8,446
  7. Avatar for katling 67. katling Lv 1 12 pts. 8,446
  8. Avatar for greepski 68. greepski Lv 1 11 pts. 8,444
  9. Avatar for lupussapien 69. lupussapien Lv 1 11 pts. 8,444
  10. Avatar for rsosborne 70. rsosborne Lv 1 10 pts. 8,442

Comments