Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for ppp6 81. ppp6 Lv 1 6 pts. 8,404
  2. Avatar for Flagg65a 82. Flagg65a Lv 1 6 pts. 8,401
  3. Avatar for Alistair69 83. Alistair69 Lv 1 6 pts. 8,394
  4. Avatar for Vinara 84. Vinara Lv 1 6 pts. 8,391
  5. Avatar for SKSbell 85. SKSbell Lv 1 5 pts. 8,385
  6. Avatar for stomjoh 86. stomjoh Lv 1 5 pts. 8,384
  7. Avatar for pfirth 87. pfirth Lv 1 5 pts. 8,382
  8. Avatar for Datstandin 88. Datstandin Lv 1 5 pts. 8,379
  9. Avatar for Deleted player 89. Deleted player pts. 8,377
  10. Avatar for mitarcher 90. mitarcher Lv 1 4 pts. 8,374

Comments