Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for dahast.de 181. dahast.de Lv 1 1 pt. 7,415
  2. Avatar for D001x_JenBiggs 182. D001x_JenBiggs Lv 1 1 pt. 6,216
  3. Avatar for Takashi_Yoshida 183. Takashi_Yoshida Lv 1 1 pt. 5,842
  4. Avatar for Hollinas 184. Hollinas Lv 1 1 pt. 4,822
  5. Avatar for spvincent 185. spvincent Lv 1 1 pt. 4,822
  6. Avatar for potatopotatopotato 186. potatopotatopotato Lv 1 1 pt. 4,822

Comments