Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,314
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 9,299
  3. Avatar for markm457 3. markm457 Lv 1 94 pts. 9,297
  4. Avatar for eusair 4. eusair Lv 1 92 pts. 9,291
  5. Avatar for actiasluna 5. actiasluna Lv 1 89 pts. 9,284
  6. Avatar for pmdpmd 6. pmdpmd Lv 1 86 pts. 9,276
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 83 pts. 9,272
  8. Avatar for gitwut 8. gitwut Lv 1 81 pts. 9,272
  9. Avatar for pauldunn 9. pauldunn Lv 1 78 pts. 9,267
  10. Avatar for crpainter 10. crpainter Lv 1 76 pts. 9,248

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).