Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,317
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 81 pts. 9,315
  3. Avatar for toshiue 3. toshiue Lv 1 65 pts. 9,310
  4. Avatar for pauldunn 4. pauldunn Lv 1 52 pts. 9,306
  5. Avatar for Galaxie 5. Galaxie Lv 1 41 pts. 9,304
  6. Avatar for LociOiling 6. LociOiling Lv 1 32 pts. 9,298
  7. Avatar for smilingone 7. smilingone Lv 1 24 pts. 9,298
  8. Avatar for reefyrob 8. reefyrob Lv 1 18 pts. 9,296
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 14 pts. 9,294
  10. Avatar for ManVsYard 10. ManVsYard Lv 1 10 pts. 9,282

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).