Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,317
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 81 pts. 9,315
  3. Avatar for toshiue 3. toshiue Lv 1 65 pts. 9,310
  4. Avatar for pauldunn 4. pauldunn Lv 1 52 pts. 9,306
  5. Avatar for Galaxie 5. Galaxie Lv 1 41 pts. 9,304
  6. Avatar for LociOiling 6. LociOiling Lv 1 32 pts. 9,298
  7. Avatar for smilingone 7. smilingone Lv 1 24 pts. 9,298
  8. Avatar for reefyrob 8. reefyrob Lv 1 18 pts. 9,296
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 14 pts. 9,294
  10. Avatar for ManVsYard 10. ManVsYard Lv 1 10 pts. 9,282

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).