Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,317
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,304
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,299
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,284
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,276
  6. Avatar for Contenders 6. Contenders 14 pts. 9,272
  7. Avatar for Russian team 7. Russian team 8 pts. 9,233
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,210
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,134
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,121

  1. Avatar for smholst 11. smholst Lv 1 7 pts. 9,280
  2. Avatar for Hollinas 12. Hollinas Lv 1 5 pts. 9,276
  3. Avatar for Deleted player 13. Deleted player pts. 9,270
  4. Avatar for gitwut 14. gitwut Lv 1 3 pts. 9,269
  5. Avatar for lamoille 15. lamoille Lv 1 2 pts. 9,261
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 1 pt. 9,259
  7. Avatar for mimi 17. mimi Lv 1 1 pt. 9,256
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 9,251
  9. Avatar for alwen 19. alwen Lv 1 1 pt. 9,244
  10. Avatar for actiasluna 20. actiasluna Lv 1 1 pt. 9,228

Comments


actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).