Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,317
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,304
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,299
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,284
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,276
  6. Avatar for Contenders 6. Contenders 14 pts. 9,272
  7. Avatar for Russian team 7. Russian team 8 pts. 9,233
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,210
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,134
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,121
  1. Avatar for lamoille 141. lamoille Lv 1 1 pt. 8,152
  2. Avatar for cherry39 142. cherry39 Lv 1 1 pt. 8,136
  3. Avatar for spvincent 143. spvincent Lv 1 1 pt. 8,130
  4. Avatar for muffnerk 144. muffnerk Lv 1 1 pt. 8,061
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 8,049
  6. Avatar for pablokkk 146. pablokkk Lv 1 1 pt. 8,043
  7. Avatar for Gorkasmatzaile 147. Gorkasmatzaile Lv 1 1 pt. 8,025
  8. Avatar for parsnip 148. parsnip Lv 1 1 pt. 7,978
  9. Avatar for MicheleVerret 149. MicheleVerret Lv 1 1 pt. 7,955
  10. Avatar for Cerzax 150. Cerzax Lv 1 1 pt. 7,889

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).