Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,741
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,728
  3. Avatar for Deleted group 14. Deleted group pts. 8,712
  4. Avatar for :) 15. :) 1 pt. 8,597
  5. Avatar for xkcd 16. xkcd 1 pt. 8,583
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,544
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,415
  8. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,860

  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 8,932
  2. Avatar for smilingone 2. smilingone Lv 1 97 pts. 8,928
  3. Avatar for gitwut 3. gitwut Lv 1 94 pts. 8,927
  4. Avatar for tokens 4. tokens Lv 1 91 pts. 8,927
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 8,926
  6. Avatar for crpainter 6. crpainter Lv 1 86 pts. 8,926
  7. Avatar for markm457 7. markm457 Lv 1 83 pts. 8,921
  8. Avatar for nicobul 8. nicobul Lv 1 80 pts. 8,913
  9. Avatar for LociOiling 9. LociOiling Lv 1 78 pts. 8,909
  10. Avatar for Galaxie 10. Galaxie Lv 1 75 pts. 8,909

Comments