Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,933
  2. Avatar for Go Science 2. Go Science 77 pts. 8,929
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,927
  4. Avatar for Contenders 4. Contenders 43 pts. 8,927
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,913
  6. Avatar for HMT heritage 6. HMT heritage 22 pts. 8,890
  7. Avatar for Russian team 7. Russian team 15 pts. 8,887
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 8,886
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,841
  10. Avatar for freefolder 10. freefolder 5 pts. 8,783

  1. Avatar for frood66 91. frood66 Lv 1 2 pts. 8,679
  2. Avatar for Hollinas 92. Hollinas Lv 1 2 pts. 8,678
  3. Avatar for jebbiek 93. jebbiek Lv 1 2 pts. 8,672
  4. Avatar for cobaltteal 94. cobaltteal Lv 1 2 pts. 8,667
  5. Avatar for trentis1 95. trentis1 Lv 1 2 pts. 8,667
  6. Avatar for senor pit 96. senor pit Lv 1 2 pts. 8,660
  7. Avatar for harvardman 97. harvardman Lv 1 2 pts. 8,654
  8. Avatar for uihcv 98. uihcv Lv 1 1 pt. 8,647
  9. Avatar for katling 99. katling Lv 1 1 pt. 8,645
  10. Avatar for SKSbell 100. SKSbell Lv 1 1 pt. 8,644

Comments