Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,933
  2. Avatar for Go Science 2. Go Science 77 pts. 8,929
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,927
  4. Avatar for Contenders 4. Contenders 43 pts. 8,927
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,913
  6. Avatar for HMT heritage 6. HMT heritage 22 pts. 8,890
  7. Avatar for Russian team 7. Russian team 15 pts. 8,887
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 8,886
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,841
  10. Avatar for freefolder 10. freefolder 5 pts. 8,783

  1. Avatar for justkae 151. justkae Lv 1 1 pt. 8,284
  2. Avatar for claire_kermit 152. claire_kermit Lv 1 1 pt. 8,272
  3. Avatar for racingsnailrider 153. racingsnailrider Lv 1 1 pt. 7,884
  4. Avatar for aspadistra 154. aspadistra Lv 1 1 pt. 7,860
  5. Avatar for 01010011111 155. 01010011111 Lv 1 1 pt. 7,832
  6. Avatar for blue ears 156. blue ears Lv 1 1 pt. 4,532
  7. Avatar for DNALVR 157. DNALVR Lv 1 1 pt. 4,532
  8. Avatar for leakey0216 158. leakey0216 Lv 1 1 pt. 4,532
  9. Avatar for alcor29 159. alcor29 Lv 1 1 pt. 4,532
  10. Avatar for Jonathan Shilen 160. Jonathan Shilen Lv 1 1 pt. 4,532

Comments