Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  5. Avatar for SHELL 17. SHELL 1 pt. 7,807
  6. Avatar for Window Group 18. Window Group 1 pt. 3,071

  1. Avatar for harvardman 91. harvardman Lv 1 2 pts. 8,975
  2. Avatar for YGK 92. YGK Lv 1 2 pts. 8,972
  3. Avatar for Flagg65a 93. Flagg65a Lv 1 2 pts. 8,936
  4. Avatar for FishKAA 94. FishKAA Lv 1 2 pts. 8,920
  5. Avatar for cbwest 95. cbwest Lv 1 2 pts. 8,917
  6. Avatar for weitzen 96. weitzen Lv 1 2 pts. 8,893
  7. Avatar for jinhd6 97. jinhd6 Lv 1 1 pt. 8,860
  8. Avatar for versat82 98. versat82 Lv 1 1 pt. 8,850
  9. Avatar for Ref_Jo 99. Ref_Jo Lv 1 1 pt. 8,843
  10. Avatar for momadoc 100. momadoc Lv 1 1 pt. 8,818

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!