Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  5. Avatar for SHELL 17. SHELL 1 pt. 7,807
  6. Avatar for Window Group 18. Window Group 1 pt. 3,071

  1. Avatar for rinze 111. rinze Lv 1 1 pt. 8,370
  2. Avatar for cinnamonkitty 112. cinnamonkitty Lv 1 1 pt. 8,347
  3. Avatar for rsosborne 113. rsosborne Lv 1 1 pt. 8,327
  4. Avatar for dbuske 114. dbuske Lv 1 1 pt. 8,216
  5. Avatar for trentis1 115. trentis1 Lv 1 1 pt. 8,121
  6. Avatar for can1492 116. can1492 Lv 1 1 pt. 8,111
  7. Avatar for Schleicher 117. Schleicher Lv 1 1 pt. 8,105
  8. Avatar for xplocast1 118. xplocast1 Lv 1 1 pt. 8,061
  9. Avatar for kamilko 119. kamilko Lv 1 1 pt. 7,934
  10. Avatar for MicheleVerret 120. MicheleVerret Lv 1 1 pt. 7,884

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!