Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  5. Avatar for SHELL 17. SHELL 1 pt. 7,807
  6. Avatar for Window Group 18. Window Group 1 pt. 3,071

  1. Avatar for maman 121. maman Lv 1 1 pt. 7,854
  2. Avatar for 41622236lxk 122. 41622236lxk Lv 1 1 pt. 7,807
  3. Avatar for lange 123. lange Lv 1 1 pt. 7,768
  4. Avatar for emdee314 124. emdee314 Lv 1 1 pt. 7,754
  5. Avatar for j.wohlmann 125. j.wohlmann Lv 1 1 pt. 7,741
  6. Avatar for skracked 126. skracked Lv 1 1 pt. 7,620
  7. Avatar for DipsyDoodle2016 127. DipsyDoodle2016 Lv 1 1 pt. 7,458
  8. Avatar for SaraL 128. SaraL Lv 1 1 pt. 7,414
  9. Avatar for DScott 129. DScott Lv 1 1 pt. 7,247
  10. Avatar for jybourque 130. jybourque Lv 1 1 pt. 7,201

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!