Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  5. Avatar for SHELL 17. SHELL 1 pt. 7,807
  6. Avatar for Window Group 18. Window Group 1 pt. 3,071

  1. Avatar for we646410766 141. we646410766 Lv 1 1 pt. 5,574
  2. Avatar for larry25427 142. larry25427 Lv 1 1 pt. 5,477
  3. Avatar for 01010011111 143. 01010011111 Lv 1 1 pt. 5,153
  4. Avatar for star7777777 144. star7777777 Lv 1 1 pt. 5,111
  5. Avatar for bez.cerny 145. bez.cerny Lv 1 1 pt. 3,480
  6. Avatar for jflat06 146. jflat06 Lv 1 1 pt. 3,071
  7. Avatar for boboviz 147. boboviz Lv 1 1 pt. 0
  8. Avatar for fishercat 149. fishercat Lv 1 1 pt. 0
  9. Avatar for spvincent 150. spvincent Lv 1 1 pt. 0

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!