Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,850
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,327
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  7. Avatar for SHELL 17. SHELL 1 pt. 7,807
  8. Avatar for Window Group 18. Window Group 1 pt. 3,071
  1. Avatar for Deleted player 151. Deleted player pts. 0
  2. Avatar for Arne Heessels 152. Arne Heessels Lv 1 1 pt. 0
  3. Avatar for Voltozan 153. Voltozan Lv 1 1 pt. 0
  4. Avatar for potatopotatopotato 154. potatopotatopotato Lv 1 1 pt. 0
  5. Avatar for Uttkarsh 155. Uttkarsh Lv 1 1 pt. 0
  6. Avatar for lamoille 156. lamoille Lv 1 1 pt. 0
  7. Avatar for bkoep 157. bkoep Lv 1 1 pt. 0
  8. Avatar for MadCat08 158. MadCat08 Lv 1 1 pt. 0
  9. Avatar for ia_ia 159. ia_ia Lv 1 1 pt. 0

Comments

bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!